Lineage for d6cqua_ (6cqu A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. Protein Acetylcholinesterase [53476] (6 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [53480] (52 PDB entries)
  8. Domain d6cqua_: 6cqu A: [360813]
    automated match to d2xupa_
    complexed with 7pe, hi6, nag

Details for d6cqua_

PDB Entry: 6cqu (more details), 2.3099999999999996 Å

PDB Description: crystal structure of recombinant human acetylcholinesterase with reactivator hi-6
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d6cqua_:

Sequence, based on SEQRES records: (download)

>d6cqua_ c.69.1.1 (A:) Acetylcholinesterase {Human (Homo sapiens) [TaxId: 9606]}
redaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvda
ttfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiyggg
fysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqw
vqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmg
earrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpv
vdgdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflag
vrvgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqg
arvyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywan
fartgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa

Sequence, based on observed residues (ATOM records): (download)

>d6cqua_ c.69.1.1 (A:) Acetylcholinesterase {Human (Homo sapiens) [TaxId: 9606]}
redaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvda
ttfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiyggg
fysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqw
vqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmg
earrratqlahlvgcpptggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvvd
gdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvr
vgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgar
vyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfa
rtgdpnepqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa

SCOPe Domain Coordinates for d6cqua_ are not available.

Timeline for d6cqua_:

Domains from other chains:
(mouse over for more information)
d6cqub_