Lineage for d6gu2c_ (6gu2 C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. Protein automated matches [227065] (3 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [273041] (10 PDB entries)
  8. Domain d6gu2c_: 6gu2 C: [360812]
    Other proteins in same PDB: d6gu2a1, d6gu2a2
    automated match to d1cksb_
    complexed with f9z

Details for d6gu2c_

PDB Entry: 6gu2 (more details), 2 Å

PDB Description: cdk1/cyclinb/cks2 in complex with flavopiridol
PDB Compounds: (C:) Cyclin-dependent kinases regulatory subunit 2

SCOPe Domain Sequences for d6gu2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gu2c_ d.97.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymihepe
phillfrrplpk

SCOPe Domain Coordinates for d6gu2c_ are not available.

Timeline for d6gu2c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6gu2a1, d6gu2a2