Lineage for d2hohd_ (2hoh D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2494618Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2494619Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2494861Family d.1.1.4: Fungal ribonucleases [81311] (4 protein domains)
  6. 2494872Protein RNase T1 [53939] (2 species)
  7. 2494875Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)
  8. 2494902Domain d2hohd_: 2hoh D: [36080]
    complexed with 2gp, ca, na, po4; mutant

Details for d2hohd_

PDB Entry: 2hoh (more details), 1.9 Å

PDB Description: ribonuclease t1 (n9a mutant) complexed with 2'gmp
PDB Compounds: (D:) protein (ribonuclease t1)

SCOPe Domain Sequences for d2hohd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hohd_ d.1.1.4 (D:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsacysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

SCOPe Domain Coordinates for d2hohd_:

Click to download the PDB-style file with coordinates for d2hohd_.
(The format of our PDB-style files is described here.)

Timeline for d2hohd_: