![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
![]() | Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) ![]() |
![]() | Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins) |
![]() | Protein automated matches [227065] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [273041] (10 PDB entries) |
![]() | Domain d6gu7h_: 6gu7 H: [360791] Other proteins in same PDB: d6gu7a_, d6gu7c_, d6gu7e_, d6gu7g_ automated match to d1cksb_ complexed with fb8 |
PDB Entry: 6gu7 (more details), 2.75 Å
SCOPe Domain Sequences for d6gu7h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gu7h_ d.97.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymihepe phillfrrplpk
Timeline for d6gu7h_: