SCOPe 2.08: Domain d6gubd2: 6gub D:310-432

Lineage for d6gubd2 (6gub D:310-432)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226306] (7 PDB entries)

8. Domain d6gubd2: 6gub D:310-432 [360781]
   Other proteins in same PDB: d6guba1, d6guba2, d6gubc1, d6gubc2
   automated match to d3ddqb2
   complexed with f9z

Details for d6gubd2

PDB Entry: 6gub, 2.52 Å

PDB Description: cdk2/cyclina in complex with flavopiridol

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d6gubd2:

Sequence; same for both SEQRES and ATOM records:

>d6gubd2 a.74.1.1 (D:310-432) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvtg
qswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppet
lnv

Timeline for d6gubd2:

• d6gubd2 first appeared in SCOPe 2.07