Lineage for d5zyca_ (5zyc A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. Protein D-xylose isomerase [51666] (13 species)
  7. Species Streptomyces rubiginosus [TaxId:1929] [51670] (89 PDB entries)
  8. Domain d5zyca_: 5zyc A: [360743]
    automated match to d1mnza_
    complexed with act, edo, mn

Details for d5zyca_

PDB Entry: 5zyc (more details), 1.7500000000000002 Å

PDB Description: crystal structure of glucose isomerase soaked with mn2+
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d5zyca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zyca_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces rubiginosus [TaxId: 1929]}
yqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipfg
ssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktirn
idlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaiep
kpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagklf
hidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwas
aagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefdv
daaaargmaferldqlamdhllga

SCOPe Domain Coordinates for d5zyca_ are not available.

Timeline for d5zyca_: