Lineage for d5yvoa2 (5yvo A:103-241)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. Protein Class omega GST [81352] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47632] (17 PDB entries)
  8. Domain d5yvoa2: 5yvo A:103-241 [360738]
    Other proteins in same PDB: d5yvoa1
    automated match to d1eema1
    complexed with act, mlx, so4

Details for d5yvoa2

PDB Entry: 5yvo (more details), 1.8 Å

PDB Description: human glutathione transferase omega1 covalently bound to ml175 inhibitor
PDB Compounds: (A:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d5yvoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yvoa2 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftkleevltnkkt
tffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdw
qgflelylqnspeacdygl

SCOPe Domain Coordinates for d5yvoa2 are not available.

Timeline for d5yvoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5yvoa1