Lineage for d5yvoa1 (5yvo A:3-102)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. Protein Class omega GST [81363] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [52877] (17 PDB entries)
  8. Domain d5yvoa1: 5yvo A:3-102 [360737]
    Other proteins in same PDB: d5yvoa2
    automated match to d1eema2
    complexed with act, mlx, so4

Details for d5yvoa1

PDB Entry: 5yvo (more details), 1.8 Å

PDB Description: human glutathione transferase omega1 covalently bound to ml175 inhibitor
PDB Compounds: (A:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d5yvoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yvoa1 c.47.1.5 (A:3-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
gesarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpew
ffkknpfglvpvlensqgqliyesaitceyldeaypgkkl

SCOPe Domain Coordinates for d5yvoa1 are not available.

Timeline for d5yvoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5yvoa2