SCOPe 2.08: Domain d1rn4a_: 1rn4 A:

Lineage for d1rn4a_ (1rn4 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)

8. Domain d1rn4a_: 1rn4 A: [36073]
   complexed with po4; mutant

Details for d1rn4a_

PDB Entry: 1rn4, 1.8 Å

PDB Description: his92ala mutation in ribonuclease t1 induces segmental flexibility. an x-ray study

PDB Compounds: (A:) ribonuclease t1

SCOPe Domain Sequences for d1rn4a_:

Sequence, based on SEQRES records:

>d1rn4a_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvitatgasgnnfvect

Sequence, based on observed residues (ATOM records):

>d1rn4a_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvitatnnfvect

Timeline for d1rn4a_:

• d1rn4a_ first appeared (with stable ids) in SCOP 1.55, called d1rn4__
  
• d1rn4a_ appears in SCOPe 2.07