Lineage for d1rn4a_ (1rn4 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152204Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2152205Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2152447Family d.1.1.4: Fungal ribonucleases [81311] (4 protein domains)
  6. 2152458Protein RNase T1 [53939] (2 species)
  7. 2152461Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)
  8. 2152491Domain d1rn4a_: 1rn4 A: [36073]
    complexed with po4; mutant

Details for d1rn4a_

PDB Entry: 1rn4 (more details), 1.8 Å

PDB Description: his92ala mutation in ribonuclease t1 induces segmental flexibility. an x-ray study
PDB Compounds: (A:) ribonuclease t1

SCOPe Domain Sequences for d1rn4a_:

Sequence, based on SEQRES records: (download)

>d1rn4a_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvitatgasgnnfvect

Sequence, based on observed residues (ATOM records): (download)

>d1rn4a_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvitatnnfvect

SCOPe Domain Coordinates for d1rn4a_:

Click to download the PDB-style file with coordinates for d1rn4a_.
(The format of our PDB-style files is described here.)

Timeline for d1rn4a_: