Lineage for d6n36a_ (6n36 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603536Species Chitinophaga pinensis [TaxId:485918] [360720] (1 PDB entry)
  8. 2603537Domain d6n36a_: 6n36 A: [360721]
    automated match to d5aebb_
    complexed with edo, zn

Details for d6n36a_

PDB Entry: 6n36 (more details), 1.45 Å

PDB Description: beta-lactamase from chitinophaga pinensis
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6n36a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n36a_ d.157.1.0 (A:) automated matches {Chitinophaga pinensis [TaxId: 485918]}
likdlyvdkewsadyqpfriagnlyyigtydlgmflittpkghilintgvagsdtlikah
mktlgfkfkdirilltthahydhvgamaavkqqthakmmvnekdaalladggnsdyvmgg
kgsmflpvkadrllhdgdsiqlggmkivmrqhpghtpgansflfdvkdavrtykvliani
psilndtklsgmplypevgkdyaytlkamkalkfdlwlaphagqyelhkkhqpgdaynpa
afsdragyddvldewqqiydkrvke

SCOPe Domain Coordinates for d6n36a_:

Click to download the PDB-style file with coordinates for d6n36a_.
(The format of our PDB-style files is described here.)

Timeline for d6n36a_: