SCOPe 2.08: Domain d6g3yb2: 6g3y B:136-325

Lineage for d6g3yb2 (6g3y B:136-325)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)

6. Protein 8-oxoguanine glycosylase [48160] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [419766] (3 PDB entries)

8. Domain d6g3yb2: 6g3y B:136-325 [360705]
   Other proteins in same PDB: d6g3ya1, d6g3yb1, d6g3yc1, d6g3yc3
   automated match to d2xhia2
   protein/DNA complex; complexed with act, elb, ni

Details for d6g3yb2

PDB Entry: 6g3y, 2.51 Å

PDB Description: structure of the mouse 8-oxoguanine dna glycosylase mogg1 in complex with ligand th5675

PDB Compounds: (B:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d6g3yb2:

Sequence; same for both SEQRES and ATOM records:

>d6g3yb2 a.96.1.3 (B:136-325) 8-oxoguanine glycosylase {Mouse (Mus musculus) [TaxId: 10090]}
dpteclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpnlhalagpeaeth
lrklglgyraryvrasakaileeqggpawlqqlrvapyeeahkalctlpgvgakvadcic
lmaldkpqavpvdvhvwqiahrdygwhpktsqakgpsplankelgnffrnlwgpyagwaq
avlfsadlrq

Timeline for d6g3yb2:

• d6g3yb2 first appeared in SCOPe 2.07