Lineage for d6e64b1 (6e64 B:1-107)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)
  8. Domain d6e64b1: 6e64 B:1-107 [360698]
    Other proteins in same PDB: d6e64a_, d6e64h_
    automated match to d4k3el1

Details for d6e64b1

PDB Entry: 6e64 (more details), 3.15 Å

PDB Description: crystal structure of malaria transmission-blocking antibody 85rf45.1
PDB Compounds: (B:) 85RF45.1 Fab light chain

SCOPe Domain Sequences for d6e64b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e64b1 b.1.1.0 (B:1-107) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qfvlsqpnsvstnlgstvkllckrstgnigsnyvswyqhhegrspttmiyrddqrpdgvp
drfsgsidrssnsalltidnvqtedeaayfchsystgmyifgggtkltvlg

SCOPe Domain Coordinates for d6e64b1 are not available.

Timeline for d6e64b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6e64b2
View in 3D
Domains from other chains:
(mouse over for more information)
d6e64a_, d6e64h_, d6e64l1, d6e64l2