SCOPe 2.08: Domain d6isdb1: 6isd B:30-232

Lineage for d6isdb1 (6isd B:30-232)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (16 PDB entries)
   Uniprot P93836 33-428 ! Uniprot P93836 63-459

8. Domain d6isdb1: 6isd B:30-232 [360691]
   automated match to d1sp9a1
   complexed with 5bq, co

Details for d6isdb1

PDB Entry: 6isd, 2.4 Å

PDB Description: crystal structure of arabidopsis thaliana hppd complexed with sulcotrione

PDB Compounds: (B:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d6isdb1:

Sequence, based on SEQRES records:

>d6isdb1 d.32.1.3 (B:30-232) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl
ltsgdlrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaieveda
esafsisvangaipssppivlneavtiaevklygdvvlryvsykaedtekseflpgferv
edassfpldygirrldhavgnvp

Sequence, based on observed residues (ATOM records):

>d6isdb1 d.32.1.3 (B:30-232) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl
ltsgdlrflftapyspsptttasipsfdhgscrsffsshglgvravaievedaesafsis
vangaipssppivlneavtiaevklygdvvlryvsykflpgfervefpldygirrldhav
gnvp

Timeline for d6isdb1:

• d6isdb1 first appeared in SCOPe 2.07