Lineage for d3rnt__ (3rnt -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) 
Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins) 
Protein RNase T1 [53939] (2 species) Species Aspergillus oryzae [TaxId:5062] [53940] (54 PDB entries) 
Domain d3rnt__: 3rnt - [36069]
Details for d3rnt__
PDB Entry: 3rnt (more details), 1.8 Å
PDB Description: crystal structure of guanosine-free ribonuclease t1, complexed with vanadate(v), suggests conformational change upon substrate binding
SCOP Domain Sequences for d3rnt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rnt__ d.1.1.1 (-) RNase T1 {Aspergillus oryzae}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
SCOP Domain Coordinates for d3rnt__:
Click to download the PDB-style file with coordinates for d3rnt__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3rnt__:
- d3rnt__ appears in SCOP 1.57
- d3rnt__ appears in the current release, SCOPe 2.08, called d3rnta_
View in 3D