Lineage for d6bopc_ (6bop C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. Family a.103.1.0: automated matches [191476] (1 protein)
    not a true family
  6. Protein automated matches [190763] (12 species)
    not a true protein
  7. Species Neosartorya fumigata [TaxId:746128] [347633] (5 PDB entries)
  8. Domain d6bopc_: 6bop C: [360678]
    automated match to d3enja_

Details for d6bopc_

PDB Entry: 6bop (more details), 2.71 Å

PDB Description: crystal structure of 2-methylcitrate synthase from aspergillus fumigatus
PDB Compounds: (C:) 2-methylcitrate synthase, mitochondrial

SCOPe Domain Sequences for d6bopc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bopc_ a.103.1.0 (C:) automated matches {Neosartorya fumigata [TaxId: 746128]}
aepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpee
girfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlpq
hildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllaki
prvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdhe
ggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkftdd
dvrnylwdtlksgrvvpgyghavlrkpdprfqalmdfaatrpdvlanpvfqlvkknseia
pavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralgl
pierpksinllglk

SCOPe Domain Coordinates for d6bopc_ are not available.

Timeline for d6bopc_:

Domains from other chains:
(mouse over for more information)
d6bopa_, d6bopb_, d6bopd_