Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) |
Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins) |
Protein RNase T1 [53939] (2 species) |
Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries) |
Domain d1rgka_: 1rgk A: [36067] complexed with 2am, ca; mutant |
PDB Entry: 1rgk (more details), 1.87 Å
SCOPe Domain Sequences for d1rgka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rgka_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]} acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyqgfdfsvsspyyewp ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
Timeline for d1rgka_: