Lineage for d6h1ia_ (6h1i A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814905Family b.82.1.12: Pirin-like [101984] (2 proteins)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin
  6. 2814909Protein Pirin [101985] (1 species)
    Bcl-3 and nuclear factor I-interacting protein
  7. 2814910Species Human (Homo sapiens) [TaxId:9606] [101986] (13 PDB entries)
  8. 2814915Domain d6h1ia_: 6h1i A: [360645]
    automated match to d4ewea_
    complexed with fe, fjh, gol

Details for d6h1ia_

PDB Entry: 6h1i (more details), 1.69 Å

PDB Description: crystal structure of human pirin in complex with bisamide compound 2
PDB Compounds: (A:) Pirin

SCOPe Domain Sequences for d6h1ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h1ia_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]}
skkvtlsvlsreqsegvgarvrrsigrpelknldpfllfdefkggrpggfpdhphrgfet
vsylleggsmahedfcghtgkmnpgdlqwmtagrgilhaempcseepahglqlwvnlrss
ekmvepqyqelkseeipkpskdgvtvavisgealgikskvytrtptlyldfkldpgakhs
qpipkgwtsfiytisgdvyigpddaqqkiephhtavlgegdsvqvenkdpkrshfvliag
eplrepviqhgpfvmntneeisqaildfrnakngferaktwkskign

SCOPe Domain Coordinates for d6h1ia_:

Click to download the PDB-style file with coordinates for d6h1ia_.
(The format of our PDB-style files is described here.)

Timeline for d6h1ia_: