SCOPe 2.07: Domain d6g3ya1: 6g3y A:10-135

Lineage for d6g3ya1 (6g3y A:10-135)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.0: automated matches [227265] (1 protein)
   not a true family

6. Protein automated matches [227057] (4 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [360608] (3 PDB entries)

8. Domain d6g3ya1: 6g3y A:10-135 [360626]
   Other proteins in same PDB: d6g3ya2, d6g3yb2, d6g3yc2, d6g3yc3
   automated match to d2xhia1
   protein/DNA complex; complexed with act, elb, ni

Details for d6g3ya1

PDB Entry: 6g3y, 2.51 Å

PDB Description: structure of the mouse 8-oxoguanine dna glycosylase mogg1 in complex with ligand th5675

PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d6g3ya1:

Sequence; same for both SEQRES and ATOM records:

>d6g3ya1 d.129.1.0 (A:10-135) automated matches {Mus musculus [TaxId: 10090]}
hmrhrtlssspalwasipcprselrldlvlasgqsfrwkeqspahwsgvladqvwtltqt
edqlyctvyrgddsqvsrptleeletlhkyfqldvslaqlyshwasvdshfqrvaqkfqg
vrllrq

Timeline for d6g3ya1:

• d6g3ya1 is new in SCOPe 2.07-stable
  
• d6g3ya1 appears in the current release, SCOPe 2.08