![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.96.1: DNA-glycosylase [48150] (7 families) ![]() |
![]() | Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins) |
![]() | Protein automated matches [227058] (2 species) not a true protein |
![]() | Species Mus musculus [TaxId:10090] [360610] (3 PDB entries) |
![]() | Domain d6g3xb2: 6g3x B:136-324 [360620] Other proteins in same PDB: d6g3xa1, d6g3xa3, d6g3xb1, d6g3xb3, d6g3xc1, d6g3xc3 automated match to d2xhia2 complexed with ni |
PDB Entry: 6g3x (more details), 2.1 Å
SCOPe Domain Sequences for d6g3xb2:
Sequence, based on SEQRES records: (download)
>d6g3xb2 a.96.1.3 (B:136-324) automated matches {Mus musculus [TaxId: 10090]} dpteclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpnlhalagpeaeth lrklglgyraryvrasakaileeqggpawlqqlrvapyeeahkalctlpgvgakvadcic lmaldkpqavpvdvhvwqiahrdygwhpktsqakgpsplankelgnffrnlwgpyagwaq avlfsadlr
>d6g3xb2 a.96.1.3 (B:136-324) automated matches {Mus musculus [TaxId: 10090]} dpteclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpnlhalagpeaeth lrklglgyraryvrasakaileeqggpawlqqlrvapyeeahkalctlpgvgakvadcic lmaldkpqavpvdvhvwqiahrdygwhpktgpsplankelgnffrnlwgpyagwaqavlf sadlr
Timeline for d6g3xb2: