Lineage for d6g3xb2 (6g3x B:136-324)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334077Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2334078Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2334119Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. 2334186Protein automated matches [227058] (2 species)
    not a true protein
  7. 2334190Species Mus musculus [TaxId:10090] [360610] (3 PDB entries)
  8. 2334192Domain d6g3xb2: 6g3x B:136-324 [360620]
    Other proteins in same PDB: d6g3xa1, d6g3xa3, d6g3xb1, d6g3xb3, d6g3xc1, d6g3xc3
    automated match to d2xhia2
    complexed with ni

Details for d6g3xb2

PDB Entry: 6g3x (more details), 2.1 Å

PDB Description: native structure of the mouse 8-oxoguanine dna glycosylase mogg1
PDB Compounds: (B:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d6g3xb2:

Sequence, based on SEQRES records: (download)

>d6g3xb2 a.96.1.3 (B:136-324) automated matches {Mus musculus [TaxId: 10090]}
dpteclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpnlhalagpeaeth
lrklglgyraryvrasakaileeqggpawlqqlrvapyeeahkalctlpgvgakvadcic
lmaldkpqavpvdvhvwqiahrdygwhpktsqakgpsplankelgnffrnlwgpyagwaq
avlfsadlr

Sequence, based on observed residues (ATOM records): (download)

>d6g3xb2 a.96.1.3 (B:136-324) automated matches {Mus musculus [TaxId: 10090]}
dpteclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpnlhalagpeaeth
lrklglgyraryvrasakaileeqggpawlqqlrvapyeeahkalctlpgvgakvadcic
lmaldkpqavpvdvhvwqiahrdygwhpktgpsplankelgnffrnlwgpyagwaqavlf
sadlr

SCOPe Domain Coordinates for d6g3xb2:

Click to download the PDB-style file with coordinates for d6g3xb2.
(The format of our PDB-style files is described here.)

Timeline for d6g3xb2: