SCOPe 2.05: Domain d1i0xd_: 1i0x D:

Lineage for d1i0xd_ (1i0x D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)

8. Domain d1i0xd_: 1i0x D: [36062]
   complexed with 2gp, ca

Details for d1i0xd_

PDB Entry: 1i0x, 1.65 Å

PDB Description: ribonuclease t1 in complex with 2'gmp (form ii crystal)

PDB Compounds: (D:) guanyl-specific ribonuclease t1

SCOPe Domain Sequences for d1i0xd_:

Sequence; same for both SEQRES and ATOM records:

>d1i0xd_ d.1.1.4 (D:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
cdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewpi
lssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d1i0xd_:

• d1i0xd_ first appeared (with stable ids) in SCOP 1.55
  
• d1i0xd_ appears in SCOPe 2.04
  
• d1i0xd_ appears in SCOPe 2.06
  
• d1i0xd_ appears in the current release, SCOPe 2.08