Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) |
Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) |
Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins) |
Protein RNase T1 [53939] (2 species) |
Species Aspergillus oryzae [TaxId:5062] [53940] (54 PDB entries) |
Domain d1i0xd_: 1i0x D: [36062] |
PDB Entry: 1i0x (more details), 1.65 Å
SCOP Domain Sequences for d1i0xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i0xd_ d.1.1.1 (D:) RNase T1 {Aspergillus oryzae} cdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewpi lssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
Timeline for d1i0xd_: