Lineage for d6e65l1 (6e65 L:1-107)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d6e65l1: 6e65 L:1-107 [360615]
    Other proteins in same PDB: d6e65h_, d6e65l2
    automated match to d1lila1

Details for d6e65l1

PDB Entry: 6e65 (more details), 1.5 Å

PDB Description: crystal structure of malaria transmission-blocking antibody tb31f
PDB Compounds: (L:) TB31F Fab light chain

SCOPe Domain Sequences for d6e65l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e65l1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqphsvsespgktvtisctrstgnigsnyvswyqqrpgsspttviyrddqrpsgvp
drfsgsidrssnsasltisglktedeadyychsystgmyifgggtkltvlg

SCOPe Domain Coordinates for d6e65l1 are not available.

Timeline for d6e65l1:

Domains from same chain:
(mouse over for more information)
d6e65l2
Domains from other chains:
(mouse over for more information)
d6e65h_