Lineage for d6g3xa1 (6g3x A:11-135)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975209Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2975391Family d.129.1.0: automated matches [227265] (1 protein)
    not a true family
  6. 2975392Protein automated matches [227057] (4 species)
    not a true protein
  7. 2975410Species Mouse (Mus musculus) [TaxId:10090] [360608] (3 PDB entries)
  8. 2975411Domain d6g3xa1: 6g3x A:11-135 [360609]
    Other proteins in same PDB: d6g3xa2, d6g3xa3, d6g3xb2, d6g3xb3, d6g3xc2, d6g3xc3
    automated match to d2xhia1
    complexed with ni

Details for d6g3xa1

PDB Entry: 6g3x (more details), 2.1 Å

PDB Description: native structure of the mouse 8-oxoguanine dna glycosylase mogg1
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d6g3xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g3xa1 d.129.1.0 (A:11-135) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mrhrtlssspalwasipcprselrldlvlasgqsfrwkeqspahwsgvladqvwtltqte
dqlyctvyrgddsqvsrptleeletlhkyfqldvslaqlyshwasvdshfqrvaqkfqgv
rllrq

SCOPe Domain Coordinates for d6g3xa1:

Click to download the PDB-style file with coordinates for d6g3xa1.
(The format of our PDB-style files is described here.)

Timeline for d6g3xa1: