Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.0: automated matches [227265] (1 protein) not a true family |
Protein automated matches [227057] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [360608] (3 PDB entries) |
Domain d6g3xa1: 6g3x A:11-135 [360609] Other proteins in same PDB: d6g3xa2, d6g3xa3, d6g3xb2, d6g3xb3, d6g3xc2, d6g3xc3 automated match to d2xhia1 complexed with ni |
PDB Entry: 6g3x (more details), 2.1 Å
SCOPe Domain Sequences for d6g3xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g3xa1 d.129.1.0 (A:11-135) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mrhrtlssspalwasipcprselrldlvlasgqsfrwkeqspahwsgvladqvwtltqte dqlyctvyrgddsqvsrptleeletlhkyfqldvslaqlyshwasvdshfqrvaqkfqgv rllrq
Timeline for d6g3xa1: