Lineage for d6eeaa_ (6eea A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. Protein Carbonic anhydrase [51071] (10 species)
  7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (966 PDB entries)
    Uniprot P00918
  8. Domain d6eeaa_: 6eea A: [360597]
    automated match to d4r5aa_
    complexed with j3v, zn

Details for d6eeaa_

PDB Entry: 6eea (more details), 1.6300000000000001 Å

PDB Description: bioreductive 4-hydroxy-3-nitro-5-ureido-benzenesulfonamides selectively target the tumor-associated carbonic anhydrase isoforms ix and xii and show hypoxia-enhanced cytotoxicity against human cancer cell lines.
PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d6eeaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eeaa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
lpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

SCOPe Domain Coordinates for d6eeaa_ are not available.

Timeline for d6eeaa_: