Lineage for d9rnt__ (9rnt -)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) 
Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins) 
Protein RNase T1 [53939] (2 species) Species Aspergillus oryzae [TaxId:5062] [53940] (59 PDB entries) 
Domain d9rnt__: 9rnt - [36055]
Details for d9rnt__
PDB Entry: 9rnt (more details), 1.5 Å
PDB Description: ribonuclease t1 with free recognition and catalytic site: crystal structure analysis at 1.5 angstroms resolution
SCOP Domain Sequences for d9rnt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d9rnt__ d.1.1.1 (-) RNase T1 {Aspergillus oryzae}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
SCOP Domain Coordinates for d9rnt__:
Click to download the PDB-style file with coordinates for d9rnt__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d9rnt__:
- d9rnt__ first appeared (with stable ids) in SCOP 1.55
- d9rnt__ appears in SCOP 1.57
- d9rnt__ appears in SCOP 1.61
- d9rnt__ appears in the current release, SCOPe 2.08, called d9rnta_
View in 3D