SCOPe 2.08: Domain d6n0ua1: 6n0u A:1-294

Lineage for d6n0ua1 (6n0u A:1-294)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
   automatically mapped to Pfam PF00483

6. Protein automated matches [191218] (6 species)
   not a true protein

7. Species Paraburkholderia phymatum [TaxId:391038] [360463] (1 PDB entry)

8. Domain d6n0ua1: 6n0u A:1-294 [360549]
   Other proteins in same PDB: d6n0ua2
   automated match to d5ifya_
   complexed with edo, trh

Details for d6n0ua1

PDB Entry: 6n0u, 2.1 Å

PDB Description: crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose

PDB Compounds: (A:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d6n0ua1:

Sequence; same for both SEQRES and ATOM records:

>d6n0ua1 c.68.1.6 (A:1-294) automated matches {Paraburkholderia phymatum [TaxId: 391038]}
markgiilaggsgtrlypithvvskqllpvydkpmiyyplstlmvagirdvliistpqdt
prfeamlgdgsqwgmniqyavqpspdglaqafiigrefvgndpsalilgdnifyghdlak
qleranartdgatvfayhvhdperygvvefdkdfralsieekpakprsnyavtglyfydn
qvcdiaadikpsargeleitdvnsrylsqktldveimgrgyawldtgthdslieaatfia
tlqkrqglvvacpeeiayrrkwinaeqllalarplsknaygqylqnlltdqvaw

Timeline for d6n0ua1:

• d6n0ua1 first appeared in SCOPe 2.07