Lineage for d1rck__ (1rck -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 75820Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
  4. 75821Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) (S)
  5. 75822Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)
  6. 75927Protein RNase F1 [53937] (1 species)
  7. 75928Species Fusarium moniliforme [TaxId:117187] [53938] (4 PDB entries)
  8. 75932Domain d1rck__: 1rck - [36053]

Details for d1rck__

PDB Entry: 1rck (more details)

PDB Description: the three dimensional structure of guanine-specific ribonuclease f1 in solution determined by nmr spectroscopy and distance geometry

SCOP Domain Sequences for d1rck__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rck__ d.1.1.1 (-) RNase F1 {Fusarium moniliforme}
esattcgstnysasqvraaanaacqyyqnddtagsstyphtynnyegfdfpvdgpyqefp
iksggvytggspgadrvvintnceyagaithtgasgnnfvgcsgtn

SCOP Domain Coordinates for d1rck__:

Click to download the PDB-style file with coordinates for d1rck__.
(The format of our PDB-style files is described here.)

Timeline for d1rck__: