Lineage for d5yt8a1 (5yt8 A:3-323)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776263Species Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId:1490024] [359051] (4 PDB entries)
  8. 2776266Domain d5yt8a1: 5yt8 A:3-323 [360524]
    Other proteins in same PDB: d5yt8a2, d5yt8a3
    automated match to d4we4a_
    complexed with nag; mutant

Details for d5yt8a1

PDB Entry: 5yt8 (more details), 2.77 Å

PDB Description: crystal structure of h5 hemagglutinin with g228s q226l mutants from a/chicken/taiwan/0502/2012
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5yt8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yt8a1 b.19.1.0 (A:3-323) automated matches {Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId: 1490024]}
gdricigyhannsttqvdtimeknvtvthaqdilekehngrlcslkgvkplilkncsvag
wllgnpmcdeflnapewsyivekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifpr
sswsnhdassgvssacpyngrssffrnvvwlikknnvyrtitrtynntniedlliiwgih
hpnnaaeqiklyqnpstyvsvgtstlnqrsipeiatrpkvnglssrmeffwtilrpndsi
tfestgnfiapeyaykivkkgdsaimkselsysncdtkcqtpvgainssmpfhnvhpfai
gecpkyvklkklvlatglrni

SCOPe Domain Coordinates for d5yt8a1:

Click to download the PDB-style file with coordinates for d5yt8a1.
(The format of our PDB-style files is described here.)

Timeline for d5yt8a1: