Lineage for d1rcla_ (1rcl A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2494618Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2494619Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2494861Family d.1.1.4: Fungal ribonucleases [81311] (4 protein domains)
  6. 2494862Protein RNase F1 [53937] (1 species)
  7. 2494863Species Fusarium moniliforme [TaxId:117187] [53938] (4 PDB entries)
  8. 2494866Domain d1rcla_: 1rcl A: [36052]

Details for d1rcla_

PDB Entry: 1rcl (more details)

PDB Description: the three dimensional structure of guanine-specific ribonuclease f1 in solution determined by nmr spectroscopy and distance geometry
PDB Compounds: (A:) ribonuclease f1

SCOPe Domain Sequences for d1rcla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcla_ d.1.1.4 (A:) RNase F1 {Fusarium moniliforme [TaxId: 117187]}
esattcgstnysasqvraaanaacqyyqnddtagsstyphtynnyegfdfpvdgpyqefp
iksggvytggspgadrvvintnceyagaithtgasgnnfvgcsgtn

SCOPe Domain Coordinates for d1rcla_:

Click to download the PDB-style file with coordinates for d1rcla_.
(The format of our PDB-style files is described here.)

Timeline for d1rcla_: