Lineage for d5qj0a_ (5qj0 A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. Protein automated matches [190260] (25 species)
    not a true protein
  7. Species Hepacivirus c [TaxId:11103] [360486] (4 PDB entries)
  8. Domain d5qj0a_: 5qj0 A: [360505]
    automated match to d5pzoa_
    protein/RNA complex; complexed with 2pe, gol, j6d, scn

Details for d5qj0a_

PDB Entry: 5qj0 (more details), 2.08 Å

PDB Description: crystal structure of the hepatitis c virus genotype 2a strain jfh1 ns5b rna-dependent rna polymerase in complex with 6- [ethyl(methylsulfonyl)amino]-2-(4-fluorophenyl)-n-methyl-5-(3-{[1- (pyrimidin-2-yl)cyclopropyl]carbamoyl}phenyl)-1-benzofuran-3- carboxamide
PDB Compounds: (A:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d5qj0a_:

Sequence, based on SEQRES records: (download)

>d5qj0a_ e.8.1.4 (A:) automated matches {Hepacivirus c [TaxId: 11103]}
smsyswtgalitpcspeeeklpinplsnsslryhnkvycttsksasqrakkvtfdrtqvl
dahydsvlkdiklaaskvsarlltleeacqltpphsarskygfgakevrslsgravnhik
svwkdlledpqtpipttimaknevfcvdpakggkkparlivypdlgvrvcekmalyditq
klpqavmgasygfqyspaqrveyllkawaekkdpmgfsydtrcfdstvterdirteesiy
qacslpeeartaihslterlyvggpmfnskgqtcgyrrcrasgvlttsmgntitcyvkal
aackaagivaptmlvcgddlvvisesqgteedernlrafteamtrysappgdpprpeydl
elitscssnvsvalgprgrrryyltrdpttplaraawetvrhspinswlgniiqyaptiw
vrmvlmthffsilmvqdtldqnlnfemygsvysvnpldlpaiierlhgldafsmhtyshh
eltrvasalrklgapplrvwksraravraslisrggkaavcgrylfnwavktklkltplp
earlldlsswftvgagggdifhsvsrarp

Sequence, based on observed residues (ATOM records): (download)

>d5qj0a_ e.8.1.4 (A:) automated matches {Hepacivirus c [TaxId: 11103]}
smsyswtgalitpcspeeeklpinslryhnkvycttsksasqrakkvtfdrtqvldahyd
svlkdiklaaskvsarlltleeacqltpphsarskygfgakevrslsgravnhiksvwkd
lledpqtpipttimaknevfcvdggkkparlivypdlgvrvcekmalyditqklpqavmg
asygfqyspaqrveyllkawaekkdpmgfsydtrcfdstvterdirteesiyqacslpee
artaihslterlyvggpmfnskgqtcgyrrcrasgvlttsmgntitcyvkalaackaagi
vaptmlvcgddlvvisesqgteedernlrafteamtrysappgdpprpeydlelitscss
nvsvalgprgrrryyltrdpttplaraawetvrhsnswlgniiqyaptiwvrmvlmthff
silmvqdtldqnlnfemygsvysvnpldlpaiierlhgldafsmhtyshheltrvasalr
klgapplrvwksraravraslisrggkaavcgrylfnwavktklkltplpearlldlssw
ftvgagggdifhsvsrarp

SCOPe Domain Coordinates for d5qj0a_ are not available.

Timeline for d5qj0a_: