SCOPe 2.08: Domain d5ysua_: 5ysu A:

Lineage for d5ysua_ (5ysu A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52611] (90 PDB entries)

8. Domain d5ysua_: 5ysu A: [360499]
   Other proteins in same PDB: d5ysub_
   automated match to d2mmca_
   complexed with cl, f2x, gtp, mg, na, no3
   has additional insertions and/or extensions that are not grouped together

Details for d5ysua_

PDB Entry: 5ysu, 2.3 Å

PDB Description: plumbagin in complex with crm1-ranm189d-ranbp1

PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d5ysua_:

Sequence; same for both SEQRES and ATOM records:

>d5ysua_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevv
ddpalaaqyehdlevaqttalpdedddl

Timeline for d5ysua_:

• d5ysua_ first appeared in SCOPe 2.07