Lineage for d1sarb_ (1sar B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 713695Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 713696Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 713697Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)
  6. 713841Protein RNase Sa [53935] (1 species)
  7. 713842Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
  8. 713879Domain d1sarb_: 1sar B: [36049]
    complexed with so4

Details for d1sarb_

PDB Entry: 1sar (more details), 1.8 Å

PDB Description: determination and restrained least-squares refinement of the crystal structures of ribonuclease sa and its complex with 3'-guanylic acid at 1.8 angstroms resolution
PDB Compounds: (B:) ribonuclease sa

SCOP Domain Sequences for d1sarb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sarb_ d.1.1.2 (B:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriicgeatqedyytgdhyatfslidqtc

SCOP Domain Coordinates for d1sarb_:

Click to download the PDB-style file with coordinates for d1sarb_.
(The format of our PDB-style files is described here.)

Timeline for d1sarb_: