![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
![]() | Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
![]() | Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
![]() | Protein RNase Sa [53935] (1 species) |
![]() | Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries) Uniprot P05798 |
![]() | Domain d1rsnb_: 1rsn B: [36047] protein/RNA complex; complexed with sgp, so4 |
PDB Entry: 1rsn (more details), 2 Å
SCOPe Domain Sequences for d1rsnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rsnb_ d.1.1.2 (B:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]} dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp gartrgtrriicgeatqedyytgdhyatfslidqtc
Timeline for d1rsnb_: