Lineage for d6msyl1 (6msy L:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 3060407Domain d6msyl1: 6msy L:1-106 [360469]
    Other proteins in same PDB: d6msyh1, d6msyh2, d6msyl2
    automated match to d3cfja1
    complexed with act, man, unx

Details for d6msyl1

PDB Entry: 6msy (more details), 2 Å

PDB Description: anti-hiv-1 fab fab 2g12 + man4 re-refinement
PDB Compounds: (L:) FAB 2G12, light chain

SCOPe Domain Sequences for d6msyl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6msyl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrvei

SCOPe Domain Coordinates for d6msyl1:

Click to download the PDB-style file with coordinates for d6msyl1.
(The format of our PDB-style files is described here.)

Timeline for d6msyl1:

  • d6msyl1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22

View in 3D
Domains from same chain:
(mouse over for more information)
d6msyl2