Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (37 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [346687] (6 PDB entries) |
Domain d6ex4a2: 6ex4 A:91-199 [360468] Other proteins in same PDB: d6ex4a1, d6ex4b1 automated match to d2awpa2 complexed with fe |
PDB Entry: 6ex4 (more details), 2.4 Å
SCOPe Domain Sequences for d6ex4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ex4a2 d.44.1.0 (A:91-199) automated matches {Staphylococcus aureus [TaxId: 1280]} nseekggviddikaqwgtldefknefankattlfgsgwtwlvvndgkleivttpnqdnpl tegktpillfdvwehayylkyqnkrpdymtafwnivnwkkvdelyqaak
Timeline for d6ex4a2: