Lineage for d1rsna_ (1rsn A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013084Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 1013085Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 1013086Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 1013235Protein RNase Sa [53935] (1 species)
  7. 1013236Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
    Uniprot P05798
  8. 1013264Domain d1rsna_: 1rsn A: [36046]
    protein/RNA complex; complexed with sgp, so4

Details for d1rsna_

PDB Entry: 1rsn (more details), 2 Å

PDB Description: ribonuclease (rnase sa) (e.c.3.1.4.8) complexed with exo-2',3'-cyclophosphorothioate
PDB Compounds: (A:) ribonuclease sa

SCOPe Domain Sequences for d1rsna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsna_ d.1.1.2 (A:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriicgeatqedyytgdhyatfslidqtc

SCOPe Domain Coordinates for d1rsna_:

Click to download the PDB-style file with coordinates for d1rsna_.
(The format of our PDB-style files is described here.)

Timeline for d1rsna_: