Lineage for d6brqa1 (6brq A:87-160)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. Family a.157.1.0: automated matches [227205] (1 protein)
    not a true family
  6. Protein automated matches [226937] (1 species)
    not a true protein
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225249] (9 PDB entries)
  8. Domain d6brqa1: 6brq A:87-160 [360458]
    automated match to d3wsob2

Details for d6brqa1

PDB Entry: 6brq (more details), 2.9899999999999998 Å

PDB Description: crystal structure of rice ask1-d3 ubiquitin ligase complex crystal form 3
PDB Compounds: (A:) SKP1-like protein 1A

SCOPe Domain Sequences for d6brqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6brqa1 a.157.1.0 (A:87-160) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dadfmkidqatlfelilaanylniknlldltcqtvadmikgktpeeirttfnikndftpe
eeeevrrenqwafe

SCOPe Domain Coordinates for d6brqa1 are not available.

Timeline for d6brqa1:

Domains from other chains:
(mouse over for more information)
d6brqc1