SCOPe 2.07: Domain d6brpa1: 6brp A:4-61

Lineage for d6brpa1 (6brp A:4-61)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225248] (4 PDB entries)

8. Domain d6brpa1: 6brp A:4-61 [360454]
   Other proteins in same PDB: d6brpa2, d6brpc2
   automated match to d3wsob1

Details for d6brpa1

PDB Entry: 6brp, 2.39 Å

PDB Description: f-box protein form 2

PDB Compounds: (A:) SKP1-like protein 1A

SCOPe Domain Sequences for d6brpa1:

Sequence, based on SEQRES records:

>d6brpa1 d.42.1.0 (A:4-61) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kkivlkssdgesfeveeavalesqtiahmveddcvdngvplpnvtskilakvieyckr

Sequence, based on observed residues (ATOM records):

>d6brpa1 d.42.1.0 (A:4-61) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kkivlkssdgesfeveeavalesqtiahmvngvplpnvtskilakvieyckr

Timeline for d6brpa1:

• d6brpa1 is new in SCOPe 2.07-stable
  
• d6brpa1 appears in the current release, SCOPe 2.08