Lineage for d6brpa1 (6brp A:4-61)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. Protein automated matches [190710] (5 species)
    not a true protein
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225248] (4 PDB entries)
  8. Domain d6brpa1: 6brp A:4-61 [360454]
    Other proteins in same PDB: d6brpa2, d6brpc2
    automated match to d3wsob1

Details for d6brpa1

PDB Entry: 6brp (more details), 2.3899999999999997 Å

PDB Description: f-box protein form 2
PDB Compounds: (A:) SKP1-like protein 1A

SCOPe Domain Sequences for d6brpa1:

Sequence, based on SEQRES records: (download)

>d6brpa1 d.42.1.0 (A:4-61) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kkivlkssdgesfeveeavalesqtiahmveddcvdngvplpnvtskilakvieyckr

Sequence, based on observed residues (ATOM records): (download)

>d6brpa1 d.42.1.0 (A:4-61) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kkivlkssdgesfeveeavalesqtiahmvngvplpnvtskilakvieyckr

SCOPe Domain Coordinates for d6brpa1 are not available.

Timeline for d6brpa1:

Domains from same chain:
(mouse over for more information)
d6brpa2
Domains from other chains:
(mouse over for more information)
d6brpc1, d6brpc2