SCOPe 2.07: Domain d6if1b2: 6if1 B:157-199

Lineage for d6if1b2 (6if1 B:157-199)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140328] (10 PDB entries)
   Uniprot P61086 157-198

8. Domain d6if1b2: 6if1 B:157-199 [360435]
   Other proteins in same PDB: d6if1a1, d6if1b1, d6if1c_, d6if1d_
   automated match to d1ylaa1

Details for d6if1b2

PDB Entry: 6if1, 2.47 Å

PDB Description: crystal structure of ube2k and k48-linked di-ubiquitin complex

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 K

SCOPe Domain Sequences for d6if1b2:

Sequence; same for both SEQRES and ATOM records:

>d6if1b2 a.5.2.1 (B:157-199) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcamgfdrnavivalsskswdvetatellls

Timeline for d6if1b2:

• d6if1b2 is new in SCOPe 2.07-stable
  
• d6if1b2 appears in the current release, SCOPe 2.08