| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) ![]() automatically mapped to Pfam PF01466 |
| Family a.157.1.0: automated matches [227205] (1 protein) not a true family |
| Protein automated matches [226937] (1 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225249] (9 PDB entries) |
| Domain d6broc1: 6bro C:81-160 [360433] automated match to d3wsob2 |
PDB Entry: 6bro (more details), 2.5 Å
SCOPe Domain Sequences for d6broc1:
Sequence, based on SEQRES records: (download)
>d6broc1 a.157.1.0 (C:81-160) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ddlkawdadfmkidqatlfelilaanylniknlldltcqtvadmikgktpeeirttfnik
ndftpeeeeevrrenqwafe
>d6broc1 a.157.1.0 (C:81-160) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ddldadfmkidqatlfelilaanylniknlldltcqtvadmikgktpeeirttfnikndf
tpeeeeevrrenqwafe
Timeline for d6broc1: