SCOPe 2.01: Domain d1gmrb_: 1gmr B:

Lineage for d1gmrb_ (1gmr B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein RNase Sa [53935] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
   Uniprot P05798

8. Domain d1gmrb_: 1gmr B: [36043]
   complexed with 2gp, so4

Details for d1gmrb_

PDB Entry: 1gmr, 1.77 Å

PDB Description: complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution

PDB Compounds: (B:) ribonuclease sa

SCOPe Domain Sequences for d1gmrb_:

Sequence; same for both SEQRES and ATOM records:

>d1gmrb_ d.1.1.2 (B:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriicgeatqedyytgdhyatfslidqtc

Timeline for d1gmrb_:

• d1gmrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1gmrb_ appears in SCOP 1.75
  
• d1gmrb_ appears in SCOPe 2.02
  
• d1gmrb_ appears in the current release, SCOPe 2.08