Lineage for d6ex4b2 (6ex4 B:91-199)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. Protein automated matches [226860] (37 species)
    not a true protein
  7. Species Staphylococcus aureus [TaxId:1280] [346687] (6 PDB entries)
  8. Domain d6ex4b2: 6ex4 B:91-199 [360418]
    Other proteins in same PDB: d6ex4a1, d6ex4b1
    automated match to d2awpa2
    complexed with fe

Details for d6ex4b2

PDB Entry: 6ex4 (more details), 2.4 Å

PDB Description: staphylococcus aureus cambialistic superoxide dismutase sodm
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d6ex4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ex4b2 d.44.1.0 (B:91-199) automated matches {Staphylococcus aureus [TaxId: 1280]}
nseekggviddikaqwgtldefknefankattlfgsgwtwlvvndgkleivttpnqdnpl
tegktpillfdvwehayylkyqnkrpdymtafwnivnwkkvdelyqaak

SCOPe Domain Coordinates for d6ex4b2 are not available.

Timeline for d6ex4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ex4b1
View in 3D
Domains from other chains:
(mouse over for more information)
d6ex4a1, d6ex4a2