SCOPe 2.07: Domain d6ex4b1: 6ex4 B:2-90

Lineage for d6ex4b1 (6ex4 B:2-90)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (38 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [346685] (6 PDB entries)

8. Domain d6ex4b1: 6ex4 B:2-90 [360417]
   Other proteins in same PDB: d6ex4a2, d6ex4b2
   automated match to d2awpa1
   complexed with fe

Details for d6ex4b1

PDB Entry: 6ex4, 2.4 Å

PDB Description: staphylococcus aureus cambialistic superoxide dismutase sodm

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d6ex4b1:

Sequence; same for both SEQRES and ATOM records:

>d6ex4b1 a.2.11.0 (B:2-90) automated matches {Staphylococcus aureus [TaxId: 1280]}
afklpnlpyaydalepyidqrtmefhhdkhhntyvtklnatvegtelehqsladmianld
kvpeamrmsvrnnggghfnhslfweilsp

Timeline for d6ex4b1:

• d6ex4b1 is new in SCOPe 2.07-stable
  
• d6ex4b1 appears in the current release, SCOPe 2.08