Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
Superfamily f.19.1: Aquaporin-like [81338] (2 families) |
Family f.19.1.0: automated matches [191436] (1 protein) not a true family |
Protein automated matches [190629] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225512] (6 PDB entries) |
Domain d6f7ha_: 6f7h A: [360414] automated match to d1ldfa_ complexed with bng, gol |
PDB Entry: 6f7h (more details), 2.3 Å
SCOPe Domain Sequences for d6f7ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f7ha_ f.19.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sllarqclaeflgvfvlmlltqgavaqavtsgetkgnfftmflagslavtiaiyvggnvs gahlnpafslamcivgrlpwvklpiyilvqllsafcasgatyvlyhdalqnytggnltvt gpketasifatypapylslnngfldqvlgtgmlivgllaildrrnkgvpaglepvvvgml ilalglsmgancgiplnpardlgprlftyvagwgpevfsagngwwwvpvvaplvgatvgt atyqllvalhh
Timeline for d6f7ha_: