Lineage for d6gv4h_ (6gv4 H:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188740] (689 PDB entries)
  8. Domain d6gv4h_: 6gv4 H: [360411]
    automated match to d4y5xa_

Details for d6gv4h_

PDB Entry: 6gv4 (more details), 2.8 Å

PDB Description: high-resolution cryo-em of fab-labeled human parechovirus 3
PDB Compounds: (H:) AT12-015 antibody variable heavy

SCOPe Domain Sequences for d6gv4h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gv4h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgggdsryya
dsvkgrftisrdnskntlylqmnslgaedtalyycakrlgrvaeyyfdywgqgtlvtv

SCOPe Domain Coordinates for d6gv4h_ are not available.

Timeline for d6gv4h_:

Domains from other chains:
(mouse over for more information)
d6gv4l_