![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.1: Microbial ribonucleases [53932] (1 superfamily) |
![]() | Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) ![]() |
![]() | Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins) |
![]() | Protein RNase Sa [53935] (1 species) |
![]() | Species Streptomyces aureofaciens [TaxId:1894] [53936] (14 PDB entries) |
![]() | Domain d1ay7a_: 1ay7 A: [36041] Other proteins in same PDB: d1ay7b_ |
PDB Entry: 1ay7 (more details), 1.7 Å
SCOP Domain Sequences for d1ay7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ay7a_ d.1.1.1 (A:) RNase Sa {Streptomyces aureofaciens} dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp gartrgtrriitgeatqedyytgdhyatfslidqtc
Timeline for d1ay7a_: