Lineage for d6ex3a2 (6ex3 A:92-198)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946516Species Staphylococcus aureus [TaxId:1280] [346687] (6 PDB entries)
  8. 2946523Domain d6ex3a2: 6ex3 A:92-198 [360407]
    Other proteins in same PDB: d6ex3a1, d6ex3b1, d6ex3c1, d6ex3d1
    automated match to d2rcva2
    complexed with fe

Details for d6ex3a2

PDB Entry: 6ex3 (more details), 2.2 Å

PDB Description: staphylococcus aureus superoxide dismutase soda
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d6ex3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ex3a2 d.44.1.0 (A:92-198) automated matches {Staphylococcus aureus [TaxId: 1280]}
seekgtvvekikeqwgsleefkkefadkaaarfgsgwawlvvnngqleivttpnqdnplt
egktpilgldvwehayylkyqnkrpdyigafwnvvnwekvdelynat

SCOPe Domain Coordinates for d6ex3a2:

Click to download the PDB-style file with coordinates for d6ex3a2.
(The format of our PDB-style files is described here.)

Timeline for d6ex3a2: