Lineage for d6aica_ (6aic A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. Protein automated matches [190123] (156 species)
    not a true protein
  7. Species Staphylococcus aureus [TaxId:282458] [193407] (9 PDB entries)
  8. Domain d6aica_: 6aic A: [360400]
    automated match to d2gxqa_
    protein/RNA complex; complexed with amp

Details for d6aica_

PDB Entry: 6aic (more details), 1.8 Å

PDB Description: crystal structures of the n-terminal domain of staphylococcus aureus dead-box cold shock rna helicase csha in complex with amp
PDB Compounds: (A:) DEAD-box ATP-dependent RNA helicase CshA

SCOPe Domain Sequences for d6aica_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aica_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
nfkelgisdntvqslesmgfkeptpiqkdsipyalqgidilgqaqtgtgktgafgiplie
kvvgkqgvqslilaptrelamqvaeqlrefsrgqgvqvvtvfggmpierqikalkkgpqi
vvgtpgrvidhlnrrtlktdgihtlildeademmnmgfiddmrfimdkipavqrqtmlfs
atmpkaiqalvqqfmkspkiik

SCOPe Domain Coordinates for d6aica_ are not available.

Timeline for d6aica_: