Lineage for d6brpc2 (6brp C:80-160)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348494Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2348495Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2348542Family a.157.1.0: automated matches [227205] (1 protein)
    not a true family
  6. 2348543Protein automated matches [226937] (1 species)
    not a true protein
  7. 2348544Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225249] (9 PDB entries)
  8. 2348551Domain d6brpc2: 6brp C:80-160 [360395]
    Other proteins in same PDB: d6brpa1, d6brpc1
    automated match to d3wsob2

Details for d6brpc2

PDB Entry: 6brp (more details), 2.39 Å

PDB Description: f-box protein form 2
PDB Compounds: (C:) SKP1-like protein 1A

SCOPe Domain Sequences for d6brpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6brpc2 a.157.1.0 (C:80-160) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dddlkawdadfmkidqatlfelilaanylniknlldltcqtvadmikgktpeeirttfni
kndftpeeeeevrrenqwafe

SCOPe Domain Coordinates for d6brpc2:

Click to download the PDB-style file with coordinates for d6brpc2.
(The format of our PDB-style files is described here.)

Timeline for d6brpc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6brpc1