SCOPe 2.07: Domain d6brpc2: 6brp C:80-160

Lineage for d6brpc2 (6brp C:80-160)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.0: automated matches [227205] (1 protein)
   not a true family

6. Protein automated matches [226937] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225249] (9 PDB entries)

8. Domain d6brpc2: 6brp C:80-160 [360395]
   Other proteins in same PDB: d6brpa1, d6brpc1
   automated match to d3wsob2

Details for d6brpc2

PDB Entry: 6brp, 2.39 Å

PDB Description: f-box protein form 2

PDB Compounds: (C:) SKP1-like protein 1A

SCOPe Domain Sequences for d6brpc2:

Sequence; same for both SEQRES and ATOM records:

>d6brpc2 a.157.1.0 (C:80-160) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dddlkawdadfmkidqatlfelilaanylniknlldltcqtvadmikgktpeeirttfni
kndftpeeeeevrrenqwafe

Timeline for d6brpc2:

• d6brpc2 is new in SCOPe 2.07-stable
  
• d6brpc2 appears in the current release, SCOPe 2.08